PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03986.1.g00030.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 109aa    MW: 12670.5 Da    PI: 9.46
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03986.1.g00030.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.2e-31959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gkl+ey++
  Zpz_sc03986.1.g00030.1.sm.mk  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPRGKLHEYAT 59
                                  79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.9E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.59161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-35288IPR002100Transcription factor, MADS-box
CDDcd002659.06E-42276No hitNo description
PRINTSPR004048.1E-32323IPR002100Transcription factor, MADS-box
PfamPF003198.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP RGKLHEYATD  60
SRMDEILDRY ERYSYAEKAL ISGDSESEGN WCHEYRILKA KIETIQKCH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q9e-22174173Myocyte-specific enhancer factor 2B
1tqe_R9e-22174173Myocyte-specific enhancer factor 2B
1tqe_S9e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9630611e-128EU963061.1 Zea mays clone 257029 MADS-box transcription factor 15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645262.11e-70PREDICTED: MADS-box transcription factor 15 isoform X4
SwissprotQ6Q9I27e-72MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLJ3MI314e-70J3MI31_ORYBR; Uncharacterized protein
STRINGOB07G10630.11e-69(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.16e-52MIKC_MADS family protein